PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000841703
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 127aa    MW: 14076 Da    PI: 9.269
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000841703genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-183986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
    MDP0000841703 39 KGPWTSAEDAILVEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 86
                     79******************************************9996 PP

2Myb_DNA-binding26.61.4e-0892120130
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIart 30 
                      +g++T+eE+ l+v++++++G++ W++ a++
    MDP0000841703  92 KGAFTPEEERLIVELHAKMGNK-WARMAAH 120
                      799*******************.***9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.6823490IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-243789IPR009057Homeodomain-like
SMARTSM007172.1E-153888IPR001005SANT/Myb domain
PfamPF002491.8E-163986IPR001005SANT/Myb domain
SuperFamilySSF466892.87E-2640116IPR009057Homeodomain-like
CDDcd001676.24E-114186No hitNo description
Gene3DG3DSA:1.10.10.604.1E-1490120IPR009057Homeodomain-like
SMARTSM007173.791126IPR001005SANT/Myb domain
PROSITE profilePS512948.74691126IPR017930Myb domain
PfamPF002491.9E-792120IPR001005SANT/Myb domain
CDDcd001670.0043494120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MSRTTNESED GVLSKDQIDS PLMDESNGGS GNGGMVLKKG PWTSAEDAIL VEYVKKHGEG  60
NWNAVQKHSG LFRCGKSCRL RWANHLRPNL KKGAFTPEEE RLIVELHAKM GNKWARMAAH  120
ETIKSW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2237118585B-MYB
1h8a_C7e-223711825105MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.164071e-163fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009355092.14e-82PREDICTED: transcription factor GAMYB-like
RefseqXP_009355091.14e-82PREDICTED: transcription factor GAMYB-like
RefseqXP_008346342.15e-82PREDICTED: transcription factor GAMYB-like
SwissprotQ0JIC23e-60GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLM5X3T13e-79M5X3T1_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s07330.11e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99493240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.13e-53myb domain protein 33